| Casein kinase II, alpha chain, putative [Q4FZ09] | |
|---|---|
| Systematic Name | LMJ_0121 [Leishmania major] |
| Gene Name | |
| Molecular Weight | 44198 Da |
| Protein Sequence Size | 381 |
| Function | |
| Charge | |
| Isoelectric Point | pH |
| Description | Casein kinase II, alpha chain, putative (EC 2.7.1.37). |
| Subcellular Location | N.A.[Predict] |
| E. C. Number | 2.7.1.37 |
| Sequence | >tr|Q4FZ09|Q4FZ09_LEIMA Casein kinase II, alpha chain, putative (EC 2.7.1.37) - Leishmania major. ANVDAAAHSADGGRHGGGGGGSGDESKAKKTKPEEYEHPFWYVYRQRGVSYWDYKNARVD FNANLAPYELLQKIGRGKYSEVFRGRNRNNGCLCVLKLLKPVRYQKILREISILRNLCGG PNVVRLLDVLRDTESQTVVLVTEYVHNPTTLRNLLYSNKLSNFDMRYYLYEILRSLDFAH RRGIFHRDIKPYNVMIDHERKILRVIDWGLGEYYIHGQALNCGVATRHYKGPELLVGYRH YDYSLDIWCLGCVLAGMLFRSDPFFVGANNEDQLLQIVAVFGTKALYRYLDKYQCRISRV VESSMSALPDEHVDWRRYIKRGSVQESWCDATALDLLDKMLQFDHQDRIMAHEAMQHPFF APVRDALARDSQEHYPVARR |
| DNA Sequence | |
| Casein kinase II, alpha chain, putative Q4FZ09] | |
|---|---|
| Metabolite Information | |
| Molecular Function | |
| Biochemical Pathway | |
| Regulatory Pathway | |
| KEGG Pathways | |
| Orthologs | ||||
| Homologs | GI | Percent Identity | Evalue | Score |
| Homo sapiens | casein kinase II alpha 1 subunit isoform a [Homo sapiens] | 47 | 5e-84 | 308 |
| DEG Information | ||||
| DEG Protein | DEG Organism | Percent Identity | Evalue | Bit Score |
| YBR160w cyclin-dependent protein kinase | Saccharomyces cerevisiae | 28% | 7e-27 | 115 |
| Post Translational Modification | ||||
| PTM Type | PTM Sub Type | Score | Modification Site | Prosite ID |
| PDOC00100 | Protein kinases signatures and profile | 75-98; | PS00107 | |
| PDOC00100 | Protein kinases signatures and profile | 185-197; | PS00108 | |
| PDOC00100 | Protein kinases signatures and profile | 41.856 | 69-361 | PS50011 |
| Acylation | N-myristoylation site | 13-18; 17-22; 18-23; 19-24; 20-25; 218-223; 252-257; | PS00008 | |
| Phosphorylation | cAMP- and cGMP-dependent protein kinase phosphorylation site | 321-324; | PS00004 | |
| Phosphorylation | Casein kinase II phosphorylation site | 23-26; 32-35; 51-54; 162-165; 324-327; 328-331; 333-336; | PS00006 | |
| Phosphorylation | Protein kinase C phosphorylation site | 151-153; 158-160; | PS00005 | |
| Casein kinase II, alpha chain, putative [Q4FZ09] | ||
|---|---|---|
| Model Information | ||
| Template PDB ID | 2oxyB | |
| Percent Identity | 49% | |
| Target Region | 51-370 | |
| Template Region | 22-327 | |
| Domain Information | ||
|---|---|---|
| Domains | Start | End |
| Active Site Information | ||
|---|---|---|
| Residue | Active Site Number | Functional Part |
| ASP | 139 | Sidechain |
| LYS | 141 | Sidechain |
| ASN | 144 | Sidechain |
| THR | 177 | Sidechain (SER 194 In Template) |
| Co-Factor | |
|---|---|
| Metal | Description |
| Ligands | |||||
|---|---|---|---|---|---|
| CAS number | Name | Mol. Weight | Mol. Formula | Smile Notation | PDB Reference |
| 4,5,6,7-TETRABROMO-BENZIMIDAZOLE | 433.72 | C7 H2 Br4 N2 | Brc2c1c(ncn1)c(Br)c(Br)c2Br | 2oxy | |
| Mutational Information | ||
|---|---|---|
| Residue | Feature | Description |
|
|
|
| Modeled Protein | Template Structure |
|
|
+----------<<< P R O C H E C K S U M = M A R Y >>>----------+ | = | | /var/www/html/Services/SAVES_3/jobs/62904/Q4FZ09.pdb 2.0 320 = residues | | = | +| Ramachandran plot: 91.4% core 6.9% allow 1.7% gener 0.0% = disall | | = | +| All Ramachandrans: 8 labelled residues (out of 318) = | +| Chi1-chi2 plots: 2 labelled residues (out of 219) = | | = | | Main-chain params: 6 better 0 inside 0 worse = | | Side-chain params: 5 better 0 inside 0 worse = | | = | *| Residue properties: Max.deviation: 3.3 Bad contacts: = 3 | *| Bond len/angle: 6.0 Morris et al class: 1 = 1 2 | +| 2 cis-peptides = | | G-factors Dihedrals: 0.07 Covalent: -0.10 Overall: = 0.01 | | = | | M/c bond lengths: 99.4% within limits 0.6% highlighted = | | M/c bond angles: 94.4% within limits 5.6% highlighted = | | Planar groups: 100.0% within limits 0.0% highlighted = | | = | = +------------------------------------------------------------------------= ----+ + May be worth investigating further. * Worth investigating further. |